Return-Path: Delivered-To: Info@tictactocsaintcanut.com Received: from cl-t211-187cl.majeunesse.ca by cl-t211-187cl.majeunesse.ca with LMTP id GYXOCf/momZfMwAAV5eKQw (envelope-from ) for ; Thu, 25 Jul 2024 19:59:59 -0400 Return-path: Envelope-to: Info@tictactocsaintcanut.com Delivery-date: Thu, 25 Jul 2024 19:59:59 -0400 Received: from mta-tor-003.bell.net ([209.71.212.30]:14858 helo=cmx-torrgo001.bell.net) by cl-t211-187cl.majeunesse.ca with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.96.2) (envelope-from ) id 1sX8NL-0003Pa-19 for Info@tictactocsaintcanut.com; Thu, 25 Jul 2024 19:59:59 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=sympatico.ca; s=selector1; t=1721951998; bh=iGYvCHXzFNbm67jR7ji8m0tTH3G/OJ2hA7tu4x2kI8w=; h=To:Message-ID:Subject:MIME-Version:Content-Type:X-Originating-IP:From:Date; b=D6ki0dD8fJq+ERAQaYAKn8WeK55GBeIMBV0m49ckOlj4NLYknTeecuOlTiPdBEVQdIYcP09uvjFy9NswpD/0GEE7KkDCmR9U35Q35nn77D4NHGxqLnMojTuGlhUWcSxt9jzth/GgIBG/w7ZCFVSsKl8cThsZ95+S/6DEPbMliIF7nAkmMPAkbZTAgIIbN+rkQvJo2D7UhmJj4Jxwe+8UDshQkjXU1X0mUdkn0rAMH1Ot1B2lSCISfCTy5qt97txLg9OlaW8Dv+gkXwSaX2GAh42FgyhMBllSxy8ncyQAnxwiTZ+Fp/o+3kNw3gu2IoN1cCwzDcAyBNiJA+3ieA/JXg== X-RG-SOPHOS: Clean X-RG-VADE-SC: 0 X-RG-VADE: Clean X-RG-Env-Sender: manon.moisanc@sympatico.ca X-RG-Rigid: 669E799D007DD371 X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeeftddrieeggddviecutefuodetggdotefrodftvfcurfhrohhfihhlvgemuceugffnnfdpqfgfvfenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepvfevkffugggtfghihfffsegrtdersgdtreejnecuhfhrohhmpedfmhgrnhhonhdrmhhoihhsrghntgcumhgrnhhonhdrmhhoihhsrghntgdfuceomhgrnhhonhdrmhhoihhsrghntgesshihmhhprghtihgtohdrtggrqeenucggtffrrghtthgvrhhnpeeujeduudejtdehvdetteefkeejieeugfduueekgedthfelteffiedtvdegledtteenucfkphepudelvddrudeikedrtddrfeelpdejtddrhedvrdefgedrleeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheptghmgidqthhorhifvggstddvgedrsggvlhhlmhigqdhprhgurdhshihntghhrhhonhhoshhsrdhnvghtpdhinhgvthepudelvddrudeikedrtddrfeelpdhmrghilhhfrhhomhepmhgrnhhonhdrmhhoihhsrghntgesshihmhhprghtihgtohdrtggrpdhnsggprhgtphhtthhopeegtddprhgtphhtthhopeduledvgeeggeefsegtshhtjhdrqhgtrdgtrgdprhgtphhtthhopeeuvghnlhhimhhosehhohhtmhgrihhlrdgtohhmpdhrtghpthhtohepuegvnhhoihhttghhrghrvghtthgvvddvsehhohhtmhgrihhlrdgtohhmpdhrtghpthhtohepuehilhhouggvrghu rdgthhgrrhhlvghssehvihguvghothhrohhnrdignhdqqdgrqdehfhgrpdhrtghpthhtohepvehhrghrrhhonhdrqhhuvghvihhllhhonhesvhhiuggvohhtrhhonhdrtggrpdhrtghpthhtohepvehhrhhishhtihhnvgdvtddtudgthhgrrhgvthhtvgesohhuthhlohhokhdrtghomhdprhgtphhtthhopefirghumhgrrhduleeshhhothhmrghilhdrtghomhdprhgtphhtthhopefknhhfohesghhrohhuphgvvhgviihinhgrrdgtohhm X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from cmx-torweb024.bellmx-prd.synchronoss.net (192.168.0.39) by cmx-torrgo001.bell.net (authenticated as manon.moisanc@sympatico.ca) id 669E799D007DD371; Thu, 25 Jul 2024 19:58:57 -0400 Received: from [70.52.34.98] by webmail.bell.net with HTTP; Thu, 25 Jul 2024 19:58:55 -0400 To: Benoit Charette Cc: Sylvie Aubry , "Christine. Charette" <1924443@cstj.qc.ca>, Manon , "bcconformite1@lespetitsbaluchons.com" , Charles Bilodeau , Charles Bilodeau , Sandra Blanchette , Laurent Charest , Benoit Charette , Christine Charette <1924443@cstj.qc.ca>, Christine Charette , Christine Charette , Carole Charron , =?UTF-8?Q?Jean_Philip_B=C3=A9langer?= , Marise Gau , Suzie Gauthier , Suzie Gauthier , "giglaurie.mk@outlook.com" , Christiane Gosselin , Christiane Gosselin , Moto Illimitees , Jean Philip belanger , "Info@santedentairestcanut.com" , S JCMAhjdakjbh bhxhskschbskjbcmh , S JCMAhjdakjbh bhxhskschbskjbcmh , La fee , La fee , Julie , Ecole La petite , Ecole La petite , Yolande Lapointe , Joanie Lavoie , Sandra Lemieux , Benoit Limoges , "mmartineau@hyundaistjerome.com" , Manon Moisan , "Vezina assurance N.2833" , "noreply@sheinnotice.com" , "order-update@amazon.ca" , Suzanne Picard , Agence , "service@intl.paypal.com" , Educatout , Educatout , Joceline Tessier , Joceline Tessier , Lucie Weitman Message-ID: <2a34bd18.205a.190ec555d36.Webtop.39@sympatico.ca> Subject: Changement de e-mail pour Manon.moisanc@hotmail.com MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_33118_492551801.1721951935775" User-Agent: OWM Mail 3 X-SID: 39 X-Originating-IP: [70.52.34.98] From: "manon.moisanc manon.moisanc" Date: Thu, 25 Jul 2024 19:58:55 -0400 (EDT) X-Spam-Status: No, score=-0.2 X-Spam-Score: -1 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "cl-t211-187cl.majeunesse.ca", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Voici mon nouveau e-mail, mon message précédant me suis trompé Voici mon nouveau e-mail, mon message précédant me suis trompé Content analysis details: (-0.2 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: sympatico.ca] 0.0 RCVD_IN_VALIDITY_RPBL_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [209.71.212.30 listed in bl.score.senderscore.com] 0.0 RCVD_IN_VALIDITY_SAFE_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [209.71.212.30 listed in sa-trusted.bondedsender.org] -0.0 SPF_PASS SPF: sender matches SPF record -0.0 SPF_HELO_PASS SPF: HELO matches SPF record 0.0 HTML_MESSAGE BODY: HTML included in message -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid X-Spam-Flag: NO ------=_Part_33118_492551801.1721951935775 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: quoted-printable Voici mon nouveau e-mail, mon message pr=C3=A9c=C3=A9dant me suis tromp=C3= =A9 ------=_Part_33118_492551801.1721951935775 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable

Voici mon nouveau e-ma= il, mon message pr=C3=A9c=C3=A9dant me suis tromp=C3=A9

------=_Part_33118_492551801.1721951935775--