Return-Path: Delivered-To: info@tictactocsaintcanut.com Received: from cl-t211-187cl.majeunesse.ca by cl-t211-187cl.majeunesse.ca with LMTP id uL9TAqIKiGfCLgAAV5eKQw (envelope-from ) for ; Wed, 15 Jan 2025 14:21:06 -0500 Return-path: Envelope-to: info@tictactocsaintcanut.com Delivery-date: Wed, 15 Jan 2025 14:21:06 -0500 Received: from smtp.cogeco.ca ([193.122.131.100]:27970) by cl-t211-187cl.majeunesse.ca with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.96.2) (envelope-from ) id 1tY8ws-0003CN-2U for info@tictactocsaintcanut.com; Wed, 15 Jan 2025 14:21:05 -0500 DKIM-Signature: v=1; a=rsa-sha1; d=cogeco.ca; s=s20220419; c=relaxed/simple; q=dns/txt; i=@cogeco.ca; t=1736968824; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=1jNFtiwYmew6KwAItmsait398WE=; b=SLqI0LauJvwPO6h3L0Dk/+kD0HVdVn+/A5fGdhdSKFY+zHcUXBlJnIRohW2xcNNN EOWCP/9HeCgDK9AhE72r0XCz5ZOQWBqLKi2qeZq0pBXEo+JBfgtmReeO1B1i7tTs 28IpImp1evPTZ3b5379wm2/NJrxLbWUw+vfSnD4HmINbepDGwjdXGD+fqZZMSo5m bkMxelJKmHwbYZsBT1bM5MGPCUCTRaqclmCVFhhwWZ1PRrAE7CEfn45Zo8MW5HBq qidSDxJWogghSpC1lAb7xPuy9DRFcD+hr/tb685AgQ/7llJwVaUpWs+RDCEjjeGi cJE3d0WD/Ipz21r1tR/wAA==; X-Authed-Username: amJyYWRiZXJyeUBjb2dlY28uY2E= Received: from [10.219.153.86] ([10.219.153.86:39387] helo=md18.cogeco.email-ash1.sync.lan) by smtp.cogeco.ca (envelope-from ) (ecelerity 4.4.1.20033 r(msys-ecelerity:tags/4.4.1.0^0)) with ESMTP id 87/0F-27606-87A08876; Wed, 15 Jan 2025 14:20:24 -0500 Date: Wed, 15 Jan 2025 14:20:24 -0500 (EST) From: Infos Loyer To: actu Message-ID: <1014408994.107734024.1736968824538.JavaMail.zimbra@cogeco.ca> Subject: Re: Loyer MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="=_1430a930-2fb2-41fb-a67b-aa54c20283ee" X-Originating-IP: [162.253.129.105] X-Mailer: Zimbra 9.0.0_GA_4653 (ZimbraModernWebClient - GC109 (Windows)/9.0.0_GA_4653) Thread-Index: 9pMuls1394E//cA4WuQZ3JHFxFSehw== Thread-Topic: Loyer X-Vade-Verdict: clean X-Vade-Analysis-1: gggruggvucftvghtrhhoucdtuddrgeefuddrudehledgleejucetufdoteggodetrfdotffvucfrrhho X-Vade-Analysis-2: fhhilhgvmecuufgjpfetvefqtfdpvefqiffgvefqpdfgpfggqdevqffigfevqfdpqfgfvfenuceurghi X-Vade-Analysis-3: lhhouhhtmecufedtudenucenucfjughrpeffhffvkffugggtihfothesrgdttgeriidtjeenucfhrhho X-Vade-Analysis-4: mhepkfhnfhhoshcunfhohigvrhcuuceojhgsrhgruggsvghrrhihsegtohhgvggtohdrtggrqeenucgg X-Vade-Analysis-5: tffrrghtthgvrhhnpefgkedujedvffeujeektdekleduteehfefhleevieetfeeuuddvgfeffeeuhfeg X-Vade-Analysis-6: heenucfkphepuddtrddvudelrdduheefrdekiedpudeivddrvdehfedruddvledruddtheenucevlhhu X-Vade-Analysis-7: shhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedutddrvdduledrudehfedrkeeipdhhvghl X-Vade-Analysis-8: ohepmhguudekrdgtohhgvggtohdrvghmrghilhdqrghshhdurdhshihntgdrlhgrnhdpmhgrihhlfhhr X-Vade-Analysis-9: ohhmpehjsghrrggusggvrhhrhiestghoghgvtghordgtrgdprhgtphhtthhopegrtghtuhesmhgrihhl X-Vade-Analysis-10: rdgtrgdprhgtphhtthhopehgrghruggvrhhivghhrghlvghvhiesghhmrghilhdrtghomhdprhgtphht X-Vade-Analysis-11: thhopehgrghruggvrhhivghtrghshhdvhedvsehgmhgrihhlrdgtohhmpdhrtghpthhtohepvhgrlhgv X-Vade-Analysis-12: rhhivgesphgvthhithhsrghpphhrvghnthhishhsrghgvghsrdgtrgdprhgtphhtthhopehgrghruggv X-Vade-Analysis-13: rhhivggvughutggrthhivhgvsegsvghllhhnvghtrdgtrgdprhgtphhtthhopeguihhrvggtthhiohhn X-Vade-Analysis-14: sehvrghlshgvuggvshhflhgvuhhrshdrtggrpdhrtghpthhtohepughgsegtphgvthhrvghsohhrshgs X-Vade-Analysis-15: ohhishgsrhhirghnugdrtghomhdprhgtphhtthhopehlvghsrdhpvghtihhtshdrthhrvghsohhrshes X-Vade-Analysis-16: vhhiuggvohhtrhhonhdrtggrpdhrtghpthhtohepofgrrhhivgdqmfhimhestghpvghpvghtihhtshhp X-Vade-Analysis-17: rghtrhhiohhtvghsrdgtohhm X-Vade-Client: COGECO X-Spam-Status: No, score=0.6 X-Spam-Score: 6 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "cl-t211-187cl.majeunesse.ca", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Chers Locataires,   À ce jour 15/01/2025, nous vous informons de la mise à jour de nos coordonnées bancaires concernant le paiement de votre loyer pour le mois de  Février 2025.   Conforméme [...] Content analysis details: (0.6 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: cogeco.ca] 0.0 RCVD_IN_VALIDITY_SAFE_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [193.122.131.100 listed in sa-trusted.bondedsender.org] 0.0 RCVD_IN_VALIDITY_RPBL_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [193.122.131.100 listed in bl.score.senderscore.com] -0.0 SPF_PASS SPF: sender matches SPF record 0.0 HTML_MESSAGE BODY: HTML included in message -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid 0.8 CPANEL_LOTS_OF_EMPTY_LINE RAW: Spam that has large block of empty lines X-Spam-Flag: NO --=_1430a930-2fb2-41fb-a67b-aa54c20283ee Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 Chers Locataires,=20 =C2=A0=20 =C3=80 ce jour 15/01/2025, nous vous informons de la mise =C3=A0 jour de no= s=C2=A0coordonn=C3=A9es bancaires concernant le paiement de votre loyer pour le mois de=C2=A0 F=C3= =A9vrier=C2=A02025.=20 =C2=A0=20 Conform=C3=A9ment au contrat de location sign=C3=A9, l=E2=80=99=C3=A9ch=C3= =A9ance pour le paiement de=C2=A0votre loyer est fix=C3=A9e chaque fin de m= ois ou d=C3=A9but de mois.=C2=A0=20 Par la m=C3=AAme occasion, nous vous demandons de bien vouloir effectuer le= paiement vers notre nouveau compte=C2=A0Interac=C2=A0dont le Mail est marq= u=C3=A9 en dessous de cet email. Voil=C3=A0 l'adresse courriel du=C2=A0virement=C2=A0INTERAC:=C2=A0service.i= mmobilier68@gmail.com=20 Question de s=C3=A9curit=C3=A9=C2=A0 :=C2=A0Paiement =20 =C2=A0 R=C3=A9ponse de s=C3=A9curit=C3=A9=C2=A0 :=C2=A0facture=20 =C2=A0=20 =C2=A0=20 NB: Merci de fait la=C2=A0confirmation du transfert des fonds aupr=C3=A8s d= e votre=C2=A0banque qui a effectu=C3=A9 l=E2=80=99op=C3=A9ration afin que n= ous puissions mettre vos=C2=A0paiements =C3=A0 jour.=C2=A0=20 =C2=A0=20 Le service comptabilit=C3=A9 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 --=_1430a930-2fb2-41fb-a67b-aa54c20283ee Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable
Chers Locataires,
 
=C3=80 ce jour 15/01/2025, nous vous informons de la mise =C3= =A0 jour de nos coordonn=C3=A9es
= bancaires concernant le paiement de votre loyer pour le mois de  F=C3= =A9vrier 2025.
 
Conform=C3=A9ment au contrat de location sign=C3=A9, l=E2=80= =99=C3=A9ch=C3=A9ance pour le paiement de votre loyer= est fix=C3=A9e chaque fin de mois ou d=C3=A9but de mois. 

Par la m=C3=AAme occasion, nous vous demandons de bien vou= loir effectuer le paiement vers notre nouveau compte Interac dont= le Mail est marqu=C3=A9 en dessous de cet email.

V= oil=C3=A0 l'adresse courriel du virement INTERAC: service.immobilier68@gmail.com


Question de s=C3=A9curit=C3=A9  : Paiement
 
R=C3=A9ponse de s=C3=A9curit=C3=A9  : facture
 
 
NB: Merci de fait la confirmation du transfert des fonds = aupr=C3=A8s de votre banque qui a effectu=C3=A9 l=E2= =80=99op=C3=A9ration afin que nous puissions mettre vos paiements =C3=A0 jour. 
 
Le service comptabilit=C3=A9
--=_1430a930-2fb2-41fb-a67b-aa54c20283ee--